PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12820.1
Common NameAtMYB10, MYB10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 239aa    MW: 27316.6 Da    PI: 7.4727
Description myb domain protein 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12820.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eE e+l   + + G  +W++ ++  g+ R++k+c++rw +yl
      AT3G12820.1 16 RGPWSDEESERLRSFILKNGHQNWRSLPKLAGLMRCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding52.11.5e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++++ +G++ W++Ia+ ++ gRt++++k+ w+++l
      AT3G12820.1  69 RGNFTKEEEDTIIHLHQAYGNK-WSKIASNFP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9881163IPR017930Myb domain
SuperFamilySSF466893.03E-2814110IPR009057Homeodomain-like
SMARTSM007171.1E-81565IPR001005SANT/Myb domain
PfamPF002492.2E-121663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-211770IPR009057Homeodomain-like
CDDcd001671.52E-61863No hitNo description
PROSITE profilePS5129424.83164118IPR017930Myb domain
SMARTSM007171.5E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2771119IPR009057Homeodomain-like
CDDcd001671.45E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGNRRAPCCD KSQVKRGPWS DEESERLRSF ILKNGHQNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPGLKRG NFTKEEEDTI IHLHQAYGNK WSKIASNFPG RTDNEIKNVW NTHLKKRLVK  120
RSISSSSSDV TNHSVSSTSS SSSSISSVLQ DVIIKSERPN QEEEFGEILV EQMACGFEVD  180
APQSLECLFD DSQVPPPISK PDSLQTHGKS SDHEFWSRLI EPGFDDYNEW LIFLDNQTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23161187108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.56810.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306823420.0
Genevisible257689_at0.0
Expression AtlasAT3G12820-
AtGenExpressAT3G12820-
ATTED-IIAT3G12820-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. our results provide evidence that MYB10 and MYB72 act early in the iron-deficiency regulatory cascade to drive gene expression of NAS4 and are essential for plant survival under iron deficiency.
    [PMID: 24278034]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00352DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195860.0AY519586.1 Arabidopsis thaliana MYB transcription factor (At3g12820) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187888.11e-178myb domain protein 10
SwissprotP200245e-59MYB1_MAIZE; Myb-related protein Zm1
TrEMBLQ9LTV41e-178Q9LTV4_ARATH; MYB transcription factor
STRINGAT3G12820.11e-178(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140961624
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  6. Colangelo EP,Guerinot ML
    The essential basic helix-loop-helix protein FIT1 is required for the iron deficiency response.
    Plant Cell, 2004. 16(12): p. 3400-12
    [PMID:15539473]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Palmer CM,Hindt MN,Schmidt H,Clemens S,Guerinot ML
    MYB10 and MYB72 are required for growth under iron-limiting conditions.
    PLoS Genet., 2013. 9(11): p. e1003953
    [PMID:24278034]
  9. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]